PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01545-augustus-gene-0.17-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 451aa    MW: 46649 Da    PI: 8.2007
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01545-augustus-gene-0.17-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702218.71.3e-672233833154
                                         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaas 66 
                                                    s t++CqdCGnqakkdC+h+RCRtCCksrgfdCathvkstWvpaa+rrerq ++ a+   a +s
  maker-scaffold01545-augustus-gene-0.17-mRNA-1 223 SSTTTCQDCGNQAKKDCTHRRCRTCCKSRGFDCATHVKSTWVPAARRRERQLMAGATGVAAGSS 286
                                                    57889*********************************************99999988888888 PP

                                         DUF702  67 aaeaaskrkrelkskkqsalsstklssaeskkeletss..........lPeevsseavfrcvrv 120
                                                     +++ +k++r   +++++++s+t++s+++++++++tss          lP +v+++avf+cvrv
  maker-scaffold01545-augustus-gene-0.17-mRNA-1 287 GSTSGAKKPRLI-ASQTTTTSHTSTSNTTPPRSFDTSSshqdvsfkeaLPGQVRAPAVFKCVRV 349
                                                    899999999975.88899999***************999************************* PP

                                         DUF702 121 ssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                                                    ++v+dge+e+aYq++v+igGhvfkG+LydqG+e+
  maker-scaffold01545-augustus-gene-0.17-mRNA-1 350 TAVEDGEDEFAYQAVVKIGGHVFKGFLYDQGVEN 383
                                                    *******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.7E-62225382IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.2E-27227269IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.2E-29334381IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
VATTRRLPSD SGAFADWVAS SSSSRAAAPD ELSLGFNAGP TAPGPSSTTG PMWSSGSNTN  60
RPLNYGLATP TPTDMPMVGL RDVFVVATPA SSFHHNLNHH HHHHHHHDQS NMLSDPHSQF  120
NSSNPATALG VGVGVGVIPL LTAAPCATQN LALDDDTSNM FSNRNRSGGG IGGGGIQFWQ  180
NQQQQQQQQH AHYFKKPAIL EHGGGGNLVQ SGGGIGGSNT TSSSTTTCQD CGNQAKKDCT  240
HRRCRTCCKS RGFDCATHVK STWVPAARRR ERQLMAGATG VAAGSSGSTS GAKKPRLIAS  300
QTTTTSHTST SNTTPPRSFD TSSSHQDVSF KEALPGQVRA PAVFKCVRVT AVEDGEDEFA  360
YQAVVKIGGH VFKGFLYDQG VENNSNREGY PNISELHLGG GGGGGGGNSN GGNGGRNGAS  420
SSSPMLDPTD VYAPSGGGGL LGGSSYGNPI N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651514.11e-154PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial
SwissprotQ94CK95e-86LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A061GZE91e-139A0A061GZE9_THECC; Lateral root primordium protein-related isoform 3 (Fragment)
STRINGVIT_06s0009g03450.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.27e-68Lateral root primordium (LRP) protein-related